CookSnap is coming soon — Join the waitlist →

Turkish Sigara Borek Breakfast

Crispy, golden phyllo rolls stuffed with savory feta and spinach—a Turkish breakfast classic. Baked until shattering-crisp and served warm with yogurt and fresh herbs.

Total time
30 min
Servings
2
Calories
340
Protein
12g
Turkish Sigara Borek Breakfast
casualrusticturkishvegetariancheesecrispyflakybreakfast

Ingredients

  • 3 cups fresh spinach, roughly chopped
  • 1 cup feta cheese, crumbled
  • 8 sheets phyllo dough sheets
  • 4 tbsp olive oil
  • 1 pinch salt and pepper to taste
  • ½ cup plain Greek yogurt, for serving
  • 2 tbsp fresh dill or parsley, chopped (optional)

Instructions

  1. 1

    Heat 1 tbsp olive oil in a large skillet over medium heat, ~1 minute.

  2. 2

    Add spinach and cook, stirring occasionally, until fully wilted, ~2 minutes.

  3. 3

    Transfer spinach to a colander, squeeze out excess moisture with hands, then chop finely.

  4. 4

    Mix spinach with crumbled feta, salt, and pepper in a small bowl.

  5. 5

    Preheat oven to 400°F. Line a baking sheet with parchment paper.

  6. 6

    Lay one phyllo sheet on a clean work surface. Brush lightly with olive oil.

  7. 7

    Place 2 tbsp spinach-feta filling 1 inch from the bottom edge of the phyllo.

  8. 8

    Roll tightly into a thin cylinder, tucking edges in as you roll, like a cigar.

  9. 9

    Place seam-side down on the baking sheet. Repeat with remaining phyllo and filling.

  10. 10

    Brush all rolls with remaining olive oil. Bake 12–15 minutes until golden brown.

  11. 11

    Remove from oven. Let cool 2 minutes. Serve hot with yogurt and fresh herbs.

Tools you’ll need

  • large skillet
  • colander
  • small mixing bowl
  • baking sheet
  • parchment paper
  • pastry brush
  • cutting board

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.