CookSnap is coming soon — Join the waitlist →
Back to recipes

Sigara Borek: Crispy Cheese & Herb Rolls

Golden-fried phyllo rolls stuffed with feta, fresh herbs, and onions—a traditional Turkish breakfast pastry. Crispy, savory, and ready in under 30 minutes.

Total time
25 min
Servings
4
Calories
340
Protein
9g
Sigara Borek: Crispy Cheese & Herb Rolls
freshcasualturkishvegetariancheesecrispyflakybrunch

Ingredients

  • 8 sheets phyllo dough (thawed if frozen)
  • 1 cup feta cheese, crumbled
  • ½ medium onion, finely diced
  • ¼ cup fresh parsley, chopped
  • 2 tbsp fresh dill, chopped
  • ¼ tsp black pepper
  • ½ cup olive oil
  • 1 pinch salt to taste

Instructions

  1. 1

    Mix feta, diced onion, parsley, dill, and black pepper in a bowl until combined.

  2. 2

    Lay one phyllo sheet on a work surface. Cover remaining sheets with a damp towel.

  3. 3

    Spoon 2 tbsp filling along the bottom edge of the phyllo sheet, leaving 1 inch from edges.

  4. 4

    Fold the left and right edges inward, then roll tightly from bottom to top into a cigar shape.

  5. 5

    Repeat with remaining phyllo sheets and filling to make 8 rolls total.

  6. 6

    Heat olive oil in a 12-inch skillet over medium-high heat until it shimmers, ~2 minutes.

  7. 7

    Working in batches, fry rolls seam-side down 2–3 minutes until golden, then flip and fry 90 seconds more.

  8. 8

    Transfer to a paper towel–lined plate. Serve warm with lemon wedges if desired.

Tools you’ll need

  • mixing bowl
  • 12-inch skillet
  • slotted spoon or tongs
  • paper towels
  • cutting board and knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.