CookSnap is coming soon — Join the waitlist →
Back to recipes

Crispy Cheese & Herb Sigara Boreks

Golden, paper-thin phyllo rolls stuffed with feta, fresh herbs, and spinach, fried until crunchy. A Turkish breakfast showstopper that's ready in under 20 minutes.

Total time
18 min
Servings
2
Calories
420
Protein
12g
Crispy Cheese & Herb Sigara Boreks
rusticsatisfyingturkishvegetariancheesecrispyflakybreakfast

Ingredients

  • 8 sheets phyllo sheets (thawed if frozen)
  • ¾ cup feta cheese, crumbled
  • 1 cup fresh spinach, finely chopped
  • ¼ cup fresh parsley and dill, chopped
  • 3 tbsp butter, melted
  • 2 cups neutral oil for frying
  • ¼ tsp black pepper to taste

Instructions

  1. 1

    Mix feta, spinach, parsley, and dill in a bowl. Season with black pepper.

  2. 2

    Lay one phyllo sheet on a cutting board. Brush lightly with melted butter.

  3. 3

    Spoon 2 tbsp filling near the bottom edge. Fold bottom corner up, then roll tightly into a cigar shape, tucking in the sides as you go.

  4. 4

    Repeat with remaining phyllo sheets and filling. You should have 8 boreks.

  5. 5

    Heat oil in a medium skillet over medium-high until a phyllo edge sizzles instantly on contact, about 2 minutes.

  6. 6

    Fry boreks 90 seconds per side until deep golden brown and crispy. Work in batches if needed to avoid crowding.

  7. 7

    Transfer to a paper towel–lined plate. Serve hot with lemon wedges or yogurt if desired.

Tools you’ll need

  • large mixing bowl
  • cutting board
  • medium skillet (10–12 inch)
  • slotted spoon or tongs
  • paper towels

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.