CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Spinach & Cheese Sigara Borek

Crispy phyllo cigars filled with spiced spinach and creamy cheese, finished golden and served warm with yogurt. A classic Turkish breakfast that tastes restaurant-quality in under 30 minutes.

Total time
25 min
Servings
2
Calories
385
Protein
14g
Spinach & Cheese Sigara Borek
elegantrusticturkishvegetariancheesecrispycreamyflaky

Ingredients

  • 3 cups fresh spinach, packed
  • ¾ cup feta cheese, crumbled
  • ½ cup ricotta cheese
  • 8 sheets phyllo dough sheets
  • 4 tbsp unsalted butter, melted
  • ¼ medium onion, finely diced
  • 2 tbsp fresh dill, chopped
  • 1 tbsp fresh mint, chopped
  • ¼ tsp black pepper
  • 1 pinch salt to taste

Instructions

  1. 1

    Heat 1 tbsp oil in a large skillet over medium-high. Add diced onion and cook until translucent, 2 minutes.

  2. 2

    Add spinach and cook, stirring often, until wilted and any moisture evaporates, 3 minutes.

  3. 3

    Transfer spinach to a bowl. Cool 2 minutes, then mix in feta, ricotta, dill, mint, black pepper, and salt.

  4. 4

    Lay one phyllo sheet on a cutting board. Brush lightly with melted butter.

  5. 5

    Spoon 2 tbsp filling along the lower left edge. Fold the left corner over filling, then roll tightly like a cigar.

  6. 6

    Repeat with remaining phyllo sheets and filling to make 8 boreks total.

  7. 7

    Wipe out the skillet. Heat 2 tbsp oil over medium until shimmering, 90 seconds.

  8. 8

    Working in batches, place boreks seam-side down in the skillet. Fry 2 minutes per side until deep golden.

  9. 9

    Transfer to a paper towel-lined plate. Serve warm, optionally with Greek yogurt on the side.

Tools you’ll need

  • large skillet (10-inch)
  • cutting board
  • bowl
  • spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.