CookSnap is coming soon — Join the waitlist →
Back to recipes

Sheet-Pan Spinach & Cheese Fatayer

Crispy, flaky Lebanese hand pies stuffed with herbed spinach and cheese, baked until golden. Ready in 20 minutes with store-bought pastry.

Total time
20 min
Servings
4
Calories
280
Protein
8g
Sheet-Pan Spinach & Cheese Fatayer
casualrusticlebanesevegetariancheesecrispyflakyweeknight

Ingredients

  • 10 oz thawed frozen spinach, squeezed dry
  • ¾ cup feta cheese, crumbled
  • ⅓ cup white onion, finely diced
  • 1 whole lemon (juiced)
  • 8 sheets phyllo dough sheets
  • 3 tbsp olive oil

Instructions

  1. 1

    Mix spinach, feta, onion, lemon juice, salt, and pepper in a bowl until evenly combined.

  2. 2

    Preheat oven to 400°F. Line a sheet pan with parchment paper and lightly brush with olive oil.

  3. 3

    Lay one phyllo sheet on the pan. Brush lightly with oil, then top with a second sheet and brush again.

  4. 4

    Spoon filling along one long edge, then roll tightly and curve into a triangle. Repeat with remaining sheets.

  5. 5

    Brush all fatayer with oil. Bake for 12–15 minutes until golden brown and crispy.

  6. 6

    Cool for 2 minutes, then serve warm with flatbread or a side salad.

Tools you’ll need

  • mixing bowl
  • sheet pan
  • parchment paper
  • pastry brush

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.