CookSnap is coming soon — Join the waitlist →

Sheet Pan Spanakopita

Crispy phyllo layers stuffed with spinach, feta, and herbs, baked until golden on a single pan. A simplified Greek classic that delivers impressive results in under 30 minutes.

Total time
25 min
Servings
4
Calories
320
Protein
9g
Sheet Pan Spanakopita
rusticwholesomegreekvegetariancheesecrispyflakyweeknight

Ingredients

  • 10 oz frozen spinach, thawed and squeezed dry
  • ¾ cup feta cheese, crumbled
  • 8 sheets phyllo dough sheets
  • 4 tbsp butter, melted
  • 2 tbsp fresh dill or parsley, chopped
  • ¼ tsp salt and pepper to taste

Instructions

  1. 1

    Preheat the oven to 400°F and wait until the indicator light or beep tells you it has finished preheating, about 8 minutes.

  2. 2

    Place the thawed spinach in a clean kitchen towel and squeeze it firmly over the sink until no liquid drips out, about 30 seconds.

  3. 3

    Transfer the squeezed spinach to a medium bowl, add the crumbled feta, chopped dill, salt, and pepper, and stir with a wooden spoon until evenly combined, about 1 minute.

  4. 4

    Place a sheet pan on your work surface and lay one phyllo sheet flat on it; brush the entire surface lightly with melted butter using a pastry brush, about 20 seconds.

  5. 5

    Place a second phyllo sheet on top of the first and brush it with butter; repeat this layering process with 4 more sheets, for a total of 6 sheets, brushing each one.

  6. 6

    Spread the spinach-feta mixture evenly over the top phyllo layer in a single even layer, leaving a 1-inch border uncovered around all four edges.

  7. 7

    Layer the remaining 2 phyllo sheets on top of the filling, brushing each sheet with melted butter as you place it, just as you did with the bottom layers.

  8. 8

    Brush the top phyllo sheet with any remaining melted butter until it glistens, about 15 seconds.

  9. 9

    Slide the pan into the preheated oven and bake for 12 to 15 minutes, until the top turns the color of warm honey and the edges look darker brown.

  10. 10

    Remove the pan from the oven using oven mitts and set it on a heat-safe surface; let it cool for 2 to 3 minutes.

  11. 11

    Using a sharp knife, cut the spanakopita into 4 or 8 squares by slicing straight down from the top; run the knife through to the pan bottom in one smooth motion.

  12. 12

    Carefully slide a metal spatula under each square and transfer it to a serving plate; serve warm.

Tools you’ll need

  • oven
  • 18 × 13-inch sheet pan
  • medium mixing bowl
  • wooden spoon
  • pastry brush
  • oven mitts
  • sharp knife
  • metal spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.