CookSnap is coming soon — Join the waitlist →
Back to recipes

Crispy Cheese & Spinach Fatayer

Flaky, hand-held Lebanese pastries stuffed with melted cheese and wilted spinach, baked golden in 18 minutes. Ready-made phyllo makes this a weeknight win.

Total time
18 min
Servings
4
Calories
285
Protein
10g
Crispy Cheese & Spinach Fatayer
casualsatisfyinglebanesemediterraneanvegetariancheesecrispyflaky

Ingredients

  • 8 sheets phyllo sheets (thawed)
  • 4 tbsp butter, melted
  • 2 cups fresh spinach, packed
  • ¾ cup feta cheese, crumbled
  • ½ cup mozzarella cheese, shredded
  • ½ lemon lemon
  • 1 tsp sumac or dried oregano

Instructions

  1. 1

    Heat oven to 400°F. Toss spinach with salt, pepper, and a squeeze of lemon juice until wilted.

  2. 2

    Mix wilted spinach with feta and mozzarella in a bowl. Taste and adjust salt.

  3. 3

    Lay 1 phyllo sheet on a work surface, brush lightly with melted butter, then stack a second sheet on top.

  4. 4

    Spoon 2 tbsp filling onto the bottom left, fold into a triangle, then fold again until you reach the edge.

  5. 5

    Place fatayers seam-side down on a parchment-lined sheet pan. Brush tops with remaining butter.

  6. 6

    Bake until golden and crispy, 12–14 minutes. Sprinkle with sumac while hot. Serve immediately.

Tools you’ll need

  • oven
  • sheet pan
  • parchment paper
  • small bowl
  • pastry brush

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.