Custrd is out on the App Store — Download it free →
Back to recipes

Turkish Sesame Bread with Cheese and Olives

A quick and satisfying breakfast or snack: toasted sesame bread topped with creamy feta, juicy tomatoes, briny olives, and fresh parsley. Served with tea, it's a simple taste of Turkey in minutes.

Total time
10 min
Servings
1
Calories
420
Protein
16g
Turkish Sesame Bread with Cheese and Olives
comfortingquickturkishvegetariancheesecrispycreamyweekday breakfast

Ingredients

  • 1 whole sesame bread (simit)
  • 2 oz feta cheese
  • 4 whole black olives
  • 1 medium tomato
  • 2 tbsp fresh parsley
  • 1 tsp olive oil

Instructions

  1. 1

    Slice the 1 sesame bread horizontally and toast the cut sides in a dry skillet over medium heat until golden and crisp, about 2-3 minutes per side.

  2. 2

    While the bread toasts, crumble the 2 oz feta cheese and slice the 1 tomato into thin rounds. Pit and halve the 4 black olives.

  3. 3

    Drizzle the 1 tsp olive oil over the toasted bread, then layer the tomato slices and crumbled feta on top.

  4. 4

    Scatter the olive halves and 2 tbsp chopped parsley over the cheese. Serve warm with tea on the side.

  5. 5

    For extra flavor, add a pinch of dried oregano or red pepper flakes if you have them.

Tools you’ll need

  • skillet
  • knife
  • cutting board

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.