Turkey Avocado Sandwich
A classic deli sandwich with tender sliced turkey, creamy avocado, and crisp lettuce on bread. Ready in under 5 minutes—no cooking required.
- Total time
- 5 min
- Servings
- 1
- Calories
- 385
- Protein
- 22g
casualquickamericanturkeycrispycreamytenderweeknight
Ingredients
- 2 slices bread
- 3 oz deli turkey
- ½ whole avocado
- 2 leaves lettuce
Instructions
- 1
Slice the avocado in half, remove the pit, and scoop onto one bread slice.
- 2
Spread the avocado evenly across the bread with the back of a fork.
- 3
Layer the turkey and lettuce leaves over the avocado.
- 4
Top with the second bread slice, press gently, and cut in half diagonally.
- 5
Serve immediately with a side of pickles if desired.
Tools you’ll need
- cutting board
- knife
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
