CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Turkey Avocado Club

A classic three-layer club with crispy bacon, sliced turkey, creamy avocado, and fresh tomato on toasted bread. Assemble in minutes for a satisfying lunch or light dinner.

Total time
10 min
Servings
2
Calories
520
Protein
32g
Turkey Avocado Club
casualsatisfyingamericanturkeycrispycreamytenderweeknight

Ingredients

  • 6 oz sliced deli turkey
  • 4 strips bacon strips
  • 1 whole ripe avocado
  • 1 whole tomato
  • 6 slices bread (white, wheat, or sourdough)
  • 3 tbsp mayonnaise

Instructions

  1. 1

    Cook bacon in a skillet over medium-high heat until crispy, about 5 minutes. Transfer to a paper towel.

  2. 2

    Toast the bread slices until golden and crispy, about 2 minutes per side.

  3. 3

    Spread mayonnaise on all six toast slices. Slice the avocado and tomato into thin pieces.

  4. 4

    Layer turkey, bacon, and avocado on the first slice. Add tomato on the second slice. Stack and top with the third slice.

  5. 5

    Cut the sandwich diagonally into quarters, secure with toothpicks if needed, and serve immediately.

Tools you’ll need

  • skillet
  • paper towels
  • toaster or toaster oven
  • cutting board
  • serrated knife
  • spreader or butter knife
  • toothpicks (optional)

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.