CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Turkey Avocado Club with Citrus & Egg

Open-faced turkey, avocado, and crispy bacon on toasted bread, served with fresh oranges, kiwi, and a hard-boiled egg for a complete, colorful plate. No cooking required for the sandwich itself—just assembly and a quick toast.

Total time
15 min
Servings
2
Calories
580
Protein
32g
Turkey Avocado Club with Citrus & Egg
casuallightamericanturkeycrispycreamytenderweeknight

Ingredients

  • ½ lb sliced deli turkey
  • 1 whole avocado
  • 4 slices bacon strips
  • 4 slices bread (sourdough or wheat)
  • 2 whole hard-boiled eggs
  • 1 serving citrus (oranges & kiwi, sliced)

Instructions

  1. 1

    Cook bacon in a skillet over medium-high heat until crispy, about 6 minutes. Transfer to a plate.

  2. 2

    Toast the bread slices until golden brown and crispy, about 2 minutes per side.

  3. 3

    Slice the avocado in half, remove the pit, and scoop onto the toasted bread. Mash gently with a fork.

  4. 4

    Layer the sliced turkey and crispy bacon on top of the avocado toast. Season with salt and pepper.

  5. 5

    Arrange the sandwich on a plate alongside halved hard-boiled eggs and fresh orange and kiwi slices.

  6. 6

    Serve immediately while the toast is still warm.

Tools you’ll need

  • 12-inch skillet
  • toaster or toaster oven
  • knife
  • fork

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.