Tamago Gohan — Creamy Egg Rice Bowl
Hot steamed rice with a raw egg stirred in, soy sauce, and a touch of sesame oil — the Japanese comfort bowl that takes 10 minutes. Silky, savory, deeply satisfying.
- Total time
- 10 min
- Servings
- 2
- Calories
- 385
- Protein
- 12g
comfortsimplejapanesevegetarianeggscreamysilkyweeknight
Ingredients
- 2 cups cooked white rice (hot)
- 2 whole large eggs
- 3 tbsp soy sauce
- ½ tsp sesame oil
- 1 tbsp furikake or toasted sesame seeds (optional)
Instructions
- 1
Divide hot rice between two bowls, making a small well in the center of each.
- 2
Crack one raw egg into each well — the heat will cook the whites slightly while the yolk stays runny.
- 3
Drizzle 1.5 tbsp soy sauce and 0.25 tsp sesame oil into each bowl.
- 4
Stir vigorously with chopsticks or a fork, breaking the yolk and mixing it into the rice until creamy and silky.
- 5
Scatter furikake or sesame seeds over the top if using, then serve immediately.
Tools you’ll need
- two bowls
- chopsticks or fork
- spoon (optional, for cracking eggs)
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
