CookSnap is coming soon — Join the waitlist →
Back to recipes

Stroopwafel — Caramel Syrup Waffles

Thin, crispy Dutch waffles filled with warm caramel syrup — a viral TikTok treat that's less fussy than it sounds. Toast them if you have a waffle iron, or fry thin in a skillet and sandwich with homemade caramel.

Total time
25 min
Servings
4
Calories
385
Protein
4g
Stroopwafel — Caramel Syrup Waffles
indulgentcozydutchvegetariancrispymeltyweekenddate-night

Ingredients

  • 1.25 cups all-purpose flour
  • 5 tbsp unsalted butter, melted
  • 3 tbsp granulated sugar
  • 1 whole eggs
  • ¾ cup caramel or dulce de leche
  • ¼ tsp sea salt

Instructions

  1. 1

    Whisk flour, sugar, and sea salt together in a bowl.

  2. 2

    Add egg and melted butter, stir until a smooth, thick batter forms.

  3. 3

    Heat waffle iron (or 10-inch nonstick skillet over medium-high). Lightly butter the surface.

  4. 4

    Pour 2–3 tbsp batter into waffle iron (or skillet), close lid and cook until golden and crispy, about 2–3 minutes per side.

  5. 5

    Warm caramel in a small saucepan over low heat or microwave 30 seconds until pourable.

  6. 6

    Spread 1 tbsp warm caramel on top of one waffle, sandwich with a second waffle. Serve immediately while caramel is still melting.

Tools you’ll need

  • waffle iron (or 10-inch nonstick skillet)
  • mixing bowl
  • whisk
  • small saucepan (or microwave-safe bowl)
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.