Ssambap
A quick Korean-style rice wrap with chicken, kimchi, and fresh leaves. Perfect for a fast, flavorful meal.
- Total time
- 15 min
- Servings
- 2
- Calories
- 450
- Protein
- 35g
comfortingquickkoreandairy-freechickencrispchewyweeknight
Ingredients
- 2 cups cooked rice
- 1 lb chicken breast
- 1 cup kimchi
- 8 leaves perilla leaves
- 8 leaves lettuce leaves
- 4 sheets roasted seaweed sheets
Instructions
- 1
Slice the 1 lb chicken breast into thin strips. Heat a skillet over medium-high and cook the chicken until golden and cooked through, about 6 minutes.
- 2
Add the 1 cup kimchi to the skillet with the chicken. Cook for 2 minutes until the kimchi is warm and slightly caramelized.
- 3
Place a spoonful of the 2 cups cooked rice on a perilla leaf, then top with the chicken-kimchi mixture. Wrap and eat, or use lettuce and seaweed for variety.
Tools you’ll need
- skillet
- knife
- cutting board
Cook smarter
Get matched recipes for what’s in your fridge
Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
