Custrd is out on the App Store — Download it free →
Back to recipes

20-Min Spicy Chicken Mee Goreng

Quick stir-fried noodles tossed with shredded chicken, sweet chili, and tamarind in a blazing wok. Mamak-style heat and sticky-savory glaze in under 20 minutes.

Total time
20 min
Servings
2
Calories
520
Protein
36g
20-Min Spicy Chicken Mee Goreng
boldsatisfyingmalaysianchickenchewycrispyweeknightnoodles

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Boil noodles in salted water until al dente, about 4 minutes. Drain and set aside.

  2. Step 2

    Whisk together sweet chili sauce, tamarind paste, and broth in a bowl until smooth.

  3. Step 3

    Heat oil in a large wok or skillet over high heat until shimmering, about 90 seconds.

  4. Step 4

    Add diced red onion and cook, stirring, until just softened and fragrant, 90 seconds.

  5. Step 5

    Add chicken and noodles, pour sauce over, and toss hard for 2 minutes until noodles are coated and sauce caramelizes slightly.

  6. Step 6

    Squeeze lime juice over the top, garnish with fresh chili or chili flakes, and serve hot.

Tools you’ll need

  • large wok or 12-inch skillet
  • pot for boiling
  • small mixing bowl
  • tongs or wooden spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.