CookSnap is coming soon — Join the waitlist →
Back to recipes

20-Min Spicy Chicken Mee Goreng

Quick stir-fried noodles tossed with shredded chicken, sweet chili, and tamarind in a blazing wok. Mamak-style heat and sticky-savory glaze in under 20 minutes.

Total time
20 min
Servings
2
Calories
520
Protein
36g
20-Min Spicy Chicken Mee Goreng
boldsatisfyingmalaysianchickenchewycrispyweeknightnoodles

Ingredients

  • 1.5 cups cooked shredded chicken
  • 8 oz dried egg noodles (or ramen)
  • 3 tbsp sweet chili sauce
  • 1 tbsp tamarind paste
  • ¼ cup chicken or vegetable broth
  • 2 tbsp vegetable oil
  • ½ medium red onion
  • 1 whole fresh lime (juiced) and red chili or chili flakes

Instructions

  1. 1

    Boil noodles in salted water until al dente, about 4 minutes. Drain and set aside.

  2. 2

    Whisk together sweet chili sauce, tamarind paste, and broth in a bowl until smooth.

  3. 3

    Heat oil in a large wok or skillet over high heat until shimmering, about 90 seconds.

  4. 4

    Add diced red onion and cook, stirring, until just softened and fragrant, 90 seconds.

  5. 5

    Add chicken and noodles, pour sauce over, and toss hard for 2 minutes until noodles are coated and sauce caramelizes slightly.

  6. 6

    Squeeze lime juice over the top, garnish with fresh chili or chili flakes, and serve hot.

Tools you’ll need

  • large wok or 12-inch skillet
  • pot for boiling
  • small mixing bowl
  • tongs or wooden spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.

Craving more? Browse all Malaysian recipes →