CookSnap is coming soon — Join the waitlist →
Back to recipes

Mamak-Style Mee Goreng With Crispy Chicken

Spicy, tangy stir-fried noodles with crispy chicken, shrimp crackers, and fresh cucumber—a 25-minute weeknight take on the Malaysian hawker classic. Sweet, sour, hot, and perfectly sticky.

Total time
25 min
Servings
2
Calories
520
Protein
28g
Mamak-Style Mee Goreng With Crispy Chicken
comfortboldmalaysianchickenshrimpcrispychewyweeknight

Ingredients

  • 10 oz boneless chicken thighs, cut into bite-sized pieces
  • 8 oz fresh egg noodles or ramen
  • 2.5 tbsp chili paste (sambal oelek or sriracha)
  • 2 tbsp soy sauce
  • 1.5 tbsp lime juice
  • 1 tbsp ketchup
  • 1 medium cucumber, sliced into half-moons
  • 1 cup shrimp crackers (prawn crackers), crushed slightly

Instructions

  1. 1

    Boil egg noodles in salted water until al dente, about 3 minutes. Drain and set aside.

  2. 2

    Heat 2 tbsp oil in a large skillet over medium-high heat until it shimmers, about 90 seconds.

  3. 3

    Add chicken and cook, stirring occasionally, until edges are golden and cooked through, 6–7 minutes.

  4. 4

    Stir in chili paste and cook for 30 seconds until fragrant, then add cooked noodles, soy sauce, lime juice, and ketchup.

  5. 5

    Toss everything together over medium heat for 2 minutes until noodles are glossy and coated.

  6. 6

    Divide between bowls, top with shrimp crackers and cucumber slices. Serve immediately.

Tools you’ll need

  • large skillet (12-inch)
  • pot (2-quart)
  • tongs or wooden spoon
  • colander

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.

Craving more? Browse all Malaysian recipes →