CookSnap is coming soon — Join the waitlist →

Spicy Mee Goreng with Crispy Chicken & Satay

A complete Malaysian street-food dinner: crispy fried noodles tossed in spicy-sweet sauce, topped with pan-seared chicken, shrimp crackers, fresh cucumber, and a side of peanut satay. Packed with heat, texture, and big flavor in under 30 minutes.

Total time
28 min
Servings
2
Calories
580
Protein
32g
Spicy Mee Goreng with Crispy Chicken & Satay
boldsatisfyingmalaysianchickenshrimpcrispytendercrunchy

Ingredients

  • 8 oz fresh egg noodles (or chow mein)
  • 10 oz chicken breast, sliced thin
  • 2 tbsp gochujang or sriracha
  • 2 tbsp ketchup
  • 1 whole lime (juiced)
  • 3 tbsp peanut butter (for satay dip)
  • 1 cup shrimp crackers
  • ½ whole cucumber, sliced thin

Instructions

  1. 1

    Boil egg noodles in salted water until al dente, about 4 minutes. Drain and set aside.

  2. 2

    Heat 2 tbsp oil in a large skillet over medium-high until shimmering. Season chicken with salt and pepper.

  3. 3

    Sear chicken 3 minutes per side without stirring until golden and cooked through. Transfer to a plate.

  4. 4

    In the same skillet, add cooked noodles. Stir in gochujang, ketchup, lime juice, and 2 tbsp water until noodles are evenly coated and glossy.

  5. 5

    Return chicken to the skillet and toss to combine. Cook 1 minute until heated through.

  6. 6

    Divide noodles between plates. Top with shrimp crackers and cucumber slices. Serve satay dip (mix peanut butter with 1 tbsp water and a pinch of salt) on the side.

Tools you’ll need

  • large skillet (12-inch)
  • pot (for boiling noodles)
  • colander
  • cutting board
  • chef's knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.