CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Kajang Satay Skewers

Charred chicken and shrimp skewers glazed with a quick peanut sauce spiked with chili and lime. Kajang-style satay hits in 15 minutes with just a hot skillet.

Total time
15 min
Servings
2
Calories
485
Protein
38g
Kajang Satay Skewers
casualsatisfyingmalaysiangluten-freechickenshrimpcrispytender

Ingredients

  • ½ lb boneless chicken thighs, cut into 1-inch cubes
  • ½ lb large shrimp, peeled and deveined
  • ½ cup creamy peanut butter
  • 2 tbsp chili paste (sambal oelek or sriracha)
  • 1 whole lime (juiced)
  • ¼ cup coconut milk
  • 8 skewers wooden or metal skewers (8-inch)

Instructions

  1. 1

    If using wooden skewers, soak in water for 5 minutes. Thread chicken and shrimp alternately onto each skewer.

  2. 2

    Season skewers generously with salt and pepper on both sides.

  3. 3

    Heat oil in a large skillet over medium-high until shimmering. Sear skewers 2 minutes per side until edges char and shrimp pink.

  4. 4

    While skewers cook, whisk peanut butter, chili paste, lime juice, and coconut milk in a bowl until smooth.

  5. 5

    Transfer skewers to a plate. Pour peanut sauce into the same skillet and warm over low heat, stirring, 90 seconds.

  6. 6

    Return skewers to the skillet and coat in sauce. Serve hot with lime wedges and extra sauce for dipping.

Tools you’ll need

  • wooden or metal skewers (8-inch)
  • 12-inch skillet
  • small bowl
  • whisk
  • tongs

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.