Custrd is out on the App Store — Download it free →
Back to recipes

20-Min Kajang Satay with Peanut Sauce

Grilled chicken and shrimp skewers glazed with a spiced peanut sauce, inspired by Malaysia's famous street satay. Ready in 20 minutes with a broiler or grill pan.

Total time
20 min
Servings
2
Calories
485
Protein
42g
20-Min Kajang Satay with Peanut Sauce
casualsatisfyingmalaysianchickenshrimptenderjuicyweeknight

Ingredients

  • 1 lb boneless, skinless chicken thighs or shrimp
  • 8 pieces bamboo skewers
  • ½ cup natural peanut butter
  • 2 tbsp soy sauce
  • 2 tbsp lime juice
  • 1 tbsp chili paste or sambal oelek

Instructions

  1. 1

    Soak bamboo skewers in water for 10 minutes. Pat chicken or shrimp dry with paper towels.

  2. 2

    Thread chicken or shrimp onto skewers. Season both sides generously with salt and pepper.

  3. 3

    Whisk peanut butter, soy sauce, lime juice, chili paste, and 3 tbsp water until smooth and pourable.

  4. 4

    Heat a broiler or grill pan on high for 2 minutes. Lightly oil the surface.

  5. 5

    Broil or grill skewers 3 inches from heat, 3 minutes per side, until edges char slightly and centers cook through.

  6. 6

    Brush satay with peanut sauce on both sides during the last minute. Serve hot with extra sauce for dipping.

Tools you’ll need

  • 8 bamboo skewers
  • broiler pan or grill pan
  • whisk
  • small mixing bowl
  • pastry brush

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.