CookSnap is coming soon — Join the waitlist →
Back to recipes

Kajang Satay with Peanut Glaze

Mixed skewered protein glazed with a sweet-savory peanut sauce inspired by Kajang's signature style. Ready in 25 minutes with a broiler and one bowl.

Total time
25 min
Servings
4
Calories
420
Protein
38g
Kajang Satay with Peanut Glaze
casualsatisfyingmalaysianchickenshrimptendercrispyjuicy

Ingredients

  • 1 lb chicken breast and large shrimp (mixed), cut into 1-inch cubes
  • ½ cup creamy peanut butter
  • ¼ cup coconut milk
  • 3 tbsp soy sauce
  • 2 tbsp tamarind paste (or lime juice)
  • 2 tbsp palm sugar (or brown sugar)
  • 3 cloves garlic, minced

Instructions

  1. 1

    Thread chicken and shrimp alternately onto metal skewers, dividing evenly.

  2. 2

    Whisk peanut butter, coconut milk, soy sauce, tamarind, sugar, and garlic until smooth.

  3. 3

    Brush satay generously with half the peanut sauce, coating all sides.

  4. 4

    Broil 4 inches from heat for 8–10 minutes, turning halfway, until chicken is cooked through.

  5. 5

    Brush remaining sauce over hot skewers until glossy.

  6. 6

    Serve immediately with extra sauce for dipping.

Tools you’ll need

  • metal skewers (8–10 inches)
  • broiler pan or oven-safe sheet pan
  • small whisk
  • brush for basting

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.

Craving more? Browse all Malaysian recipes →