Kajang Satay with Peanut Glaze
Mixed skewered protein glazed with a sweet-savory peanut sauce inspired by Kajang's signature style. Ready in 25 minutes with a broiler and one bowl.
- Total time
- 25 min
- Servings
- 4
- Calories
- 420
- Protein
- 38g

casualsatisfyingmalaysianchickenshrimptendercrispyjuicy
Ingredients
- 1 lb chicken breast and large shrimp (mixed), cut into 1-inch cubes
- ½ cup creamy peanut butter
- ¼ cup coconut milk
- 3 tbsp soy sauce
- 2 tbsp tamarind paste (or lime juice)
- 2 tbsp palm sugar (or brown sugar)
- 3 cloves garlic, minced
Instructions
- 1
Thread chicken and shrimp alternately onto metal skewers, dividing evenly.
- 2
Whisk peanut butter, coconut milk, soy sauce, tamarind, sugar, and garlic until smooth.
- 3
Brush satay generously with half the peanut sauce, coating all sides.
- 4
Broil 4 inches from heat for 8–10 minutes, turning halfway, until chicken is cooked through.
- 5
Brush remaining sauce over hot skewers until glossy.
- 6
Serve immediately with extra sauce for dipping.
Tools you’ll need
- metal skewers (8–10 inches)
- broiler pan or oven-safe sheet pan
- small whisk
- brush for basting
Cook smarter
Get matched recipes for what’s in your fridge
Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.



