CookSnap is coming soon — Join the waitlist →

Malaysian Mee Goreng with Chicken & Satay

Crispy fried noodles tossed with spicy sweet-sour sauce, topped with seared chicken, satay skewers, shrimp crackers, and fresh cucumber. Complete one-pan dinner ready in 25 minutes.

Total time
25 min
Servings
2
Calories
612
Protein
38g
Malaysian Mee Goreng with Chicken & Satay
casualsatisfyingmalaysianchickenshrimpcrispytendercrunchy

Ingredients

  • 8 oz egg noodles
  • 10 oz boneless chicken breast
  • 3 tbsp chili paste (sambal oelek)
  • 2 tbsp lime juice
  • 2 tbsp oyster sauce
  • 1 tbsp coconut sugar or brown sugar
  • 6 count store-bought chicken satay skewers
  • 1 count cucumber
  • 1 cup shrimp crackers (prawn crackers)

Instructions

  1. 1

    Boil noodles in salted water until al dente, drain, and set aside.

  2. 2

    Slice cucumber into thin rounds. Heat 2 tbsp oil in a large skillet over medium-high.

  3. 3

    Pat chicken dry, season with salt and pepper. Sear 5–6 minutes per side until golden and cooked through.

  4. 4

    Remove chicken and rest 2 minutes, then slice. In the same skillet, add noodles, chili paste, lime juice, oyster sauce, and sugar.

  5. 5

    Toss noodles over medium heat until coated and fragrant, 2–3 minutes. Warm satay skewers in the pan alongside.

  6. 6

    Divide noodles between bowls. Top with sliced chicken, satay skewers, cucumber, and a handful of shrimp crackers. Serve hot.

Tools you’ll need

  • large pot for boiling noodles
  • 12-inch skillet
  • cutting board and knife
  • tongs or wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.