CookSnap is coming soon — Join the waitlist →
Back to recipes

Malaysian Mee Goreng with Chicken & Shrimp Crackers

Tangy, spicy fried noodles with stir-fried chicken, served alongside crispy shrimp crackers and cool cucumber slices. Comes together in under 25 minutes on one pan.

Total time
25 min
Servings
2
Calories
620
Protein
28g
Malaysian Mee Goreng with Chicken & Shrimp Crackers
boldsatisfyingmalaysianchickencrispytenderchewyweeknight

Ingredients

  • 8 oz fresh egg noodles
  • 10 oz boneless chicken thighs, cut into 1-inch pieces
  • 3 tbsp chili paste (sambal oelek)
  • 2 tbsp soy sauce
  • 2 tbsp ketchup
  • ½ whole lime (juiced)
  • 1 medium cucumber, sliced into 1/4-inch rounds
  • 1 cup shrimp crackers, fried

Instructions

  1. 1

    Boil the egg noodles in salted water until just tender, about 3 minutes. Drain and set aside.

  2. 2

    Heat 2 tbsp oil in a large skillet over high heat until shimmering, about 90 seconds.

  3. 3

    Add chicken pieces and stir-fry until no pink remains and edges are golden, 6–7 minutes.

  4. 4

    Stir in chili paste, then add cooked noodles, soy sauce, and ketchup. Toss constantly until noodles are glossy and well coated, 2 minutes.

  5. 5

    Squeeze lime juice over the top and taste; adjust chili paste or soy sauce as needed for balance.

  6. 6

    Serve hot alongside fresh cucumber slices and shrimp crackers on the side.

Tools you’ll need

  • large skillet (12-inch or equivalent)
  • large pot for boiling noodles
  • wooden spoon or spatula
  • tongs or chopsticks

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.

Craving more? Browse all Malaysian recipes →