Custrd is out on the App Store — Download it free →
Back to recipes

Malaysian Mee Goreng with Chicken & Shrimp Crackers

Tangy, spicy fried noodles with stir-fried chicken, served alongside crispy shrimp crackers and cool cucumber slices. Comes together in under 25 minutes on one pan.

Total time
25 min
Servings
2
Calories
620
Protein
28g
Malaysian Mee Goreng with Chicken & Shrimp Crackers
boldsatisfyingmalaysianchickencrispytenderchewyweeknight

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Boil the egg noodles in salted water until just tender, about 3 minutes. Drain and set aside.

  2. Step 2

    Heat 2 tbsp oil in a large skillet over high heat until shimmering, about 90 seconds.

  3. Step 3

    Add chicken pieces and stir-fry until no pink remains and edges are golden, 6–7 minutes.

  4. Step 4

    Stir in chili paste, then add cooked noodles, soy sauce, and ketchup. Toss constantly until noodles are glossy and well coated, 2 minutes.

  5. Step 5

    Squeeze lime juice over the top and taste; adjust chili paste or soy sauce as needed for balance.

  6. Step 6

    Serve hot alongside fresh cucumber slices and shrimp crackers on the side.

Tools you’ll need

  • large skillet (12-inch or equivalent)
  • large pot for boiling noodles
  • wooden spoon or spatula
  • tongs or chopsticks

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.