Custrd is out on the App Store — Download it free →
Back to recipes

20-Min Mee Goreng with Crispy Chicken

Malaysian street-food noodles tossed with a tangy-spicy sambal base, topped with shredded chicken and crispy fried shallots. A weeknight version that skips the slow-simmered sauce and delivers that iconic mamak flavor in under 20 minutes.

Total time
20 min
Servings
2
Calories
580
Protein
38g
20-Min Mee Goreng with Crispy Chicken
casualsatisfyingmalaysianchickencrispychewyweeknightnoodle

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Boil salted water in a large skillet, add noodles, cook until just tender (~3 minutes), drain.

  2. Step 2

    Return skillet to medium-high heat with 1 tbsp oil. Crack eggs into the pan, cook until whites set but yolks jiggle.

  3. Step 3

    Push eggs to the side. Add sambal, soy sauce, and lime juice to the pan, stir until fragrant.

  4. Step 4

    Add noodles and shredded chicken back to the skillet. Toss everything together for 2 minutes until coated.

  5. Step 5

    Transfer to a plate. Top with fried shallots and cucumber slices. Serve immediately.

Tools you’ll need

  • large skillet (12-inch)
  • pot for boiling

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.