Custrd is out on the App Store — Download it free →
Back to recipes

Spicy Cajun Alfredo with Crispy Chicken

Seared cajun-spiced chicken over creamy parmesan pasta with garlic butter and a kick of hot sauce. Ready in under 25 minutes on one skillet.

Total time
25 min
Servings
2
Calories
782
Protein
48g
Spicy Cajun Alfredo with Crispy Chicken
comfortindulgentcajunchickencrispycreamytenderweeknight

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Boil salted water in a large skillet over high heat. Add fettuccine and cook until al dente, about 8 minutes. Drain, reserving 0.5 cup pasta water.

  2. Step 2

    Pat chicken breasts dry. Coat both sides generously with cajun seasoning, salt, and black pepper.

  3. Step 3

    Melt 1 tbsp butter in the same skillet over medium-high heat. Sear chicken 4-5 minutes per side until golden and cooked through (internal temp 165°F). Transfer to a cutting board.

  4. Step 4

    Add remaining 2 tbsp butter and minced garlic to the skillet. Cook 30 seconds until fragrant, then add cream and bring to a simmer.

  5. Step 5

    Stir in parmesan until melted and smooth, about 60 seconds. Add hot sauce and 0.25 cup reserved pasta water. Stir to combine.

  6. Step 6

    Return pasta to the skillet and toss to coat. Slice chicken and arrange on top. Serve immediately.

Tools you’ll need

  • large skillet (12-inch)
  • cutting board
  • instant-read thermometer
  • tongs

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.