CookSnap is coming soon — Join the waitlist →
Back to recipes

Birria Tacos

Tender shredded beef simmered in a spiced tomato consomé, served in crispy-fried corn tortillas and dipped in the rich broth. Restaurant-quality comfort in under an hour.

Total time
50 min
Servings
4
Calories
620
Protein
48g
Birria Tacos
comfortindulgentmexicanbeeftendercrispyweeknightweekend

Ingredients

  • 2.5 lbs beef chuck, 2-inch chunks
  • 4 whole dried guajillo chiles, stems removed
  • 2 whole dried ancho chiles, stems removed
  • ½ whole onion, halved
  • 4 whole garlic cloves
  • 2 tbsp tomato paste
  • 1 tsp cumin seeds
  • 6 cups beef broth
  • 1 pinch salt and pepper to taste
  • 12 whole corn tortillas
  • ½ cup vegetable oil for frying
  • 1 set fresh cilantro, white onion, lime wedges (for garnish)

Instructions

  1. 1

    Toast guajillo and ancho chiles in a large pot over medium-high heat, pressing flat, 90 seconds per side until fragrant.

  2. 2

    Remove chiles. Add beef chunks to the same pot (no oil needed) and cook 8 minutes, stirring occasionally, until browned on all sides.

  3. 3

    Add onion half, garlic cloves, tomato paste, and cumin seeds. Stir constantly for 2 minutes until fragrant.

  4. 4

    Pour in beef broth and return toasted chiles to the pot. Bring to a boil, then reduce heat and simmer 35 minutes, covered, until beef is tender.

  5. 5

    Strain broth through a fine sieve into a separate pot, pressing on solids. Shred beef with two forks; discard chiles, onion, garlic.

  6. 6

    Return shredded beef to the broth. Season with salt and pepper. Keep warm over low heat.

  7. 7

    Heat 0.5 cup oil in a skillet over medium-high until shimmering, about 90 seconds.

  8. 8

    Working one at a time, fry each corn tortilla 15 seconds per side until crispy and edges curl slightly.

  9. 9

    Transfer fried tortillas to a paper-towel-lined plate to drain.

  10. 10

    Dip each tortilla into the warm consomé for 3 seconds to soften. Lay on a plate and fill with shredded beef.

  11. 11

    Serve immediately with a small bowl of consomé for dipping, cilantro, diced onion, and lime wedges on the side.

Tools you’ll need

  • large pot with lid
  • fine-mesh sieve or strainer
  • 12-inch skillet
  • two forks for shredding
  • paper towels
  • small serving bowls

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.