CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Spicy Beef-Stuffed Peppers

Roasted rocoto peppers stuffed with seasoned ground beef, topped with melted cheese and a bright cream sauce. Ready in 25 minutes—the TikTok version of Peru's iconic rocoto relleno.

Total time
25 min
Servings
2
Calories
385
Protein
28g
Spicy Beef-Stuffed Peppers
comfortboldperuvianbeeftendercreamyweeknightdinner

Ingredients

  • 2 large red bell peppers (or rocoto peppers if available)
  • ½ lb ground beef
  • ½ medium yellow onion, diced
  • ¾ cup queso fresco or feta cheese, crumbled
  • ½ cup sour cream or Greek yogurt
  • 1 tbsp white vinegar
  • 2 tbsp fresh cilantro, chopped

Instructions

  1. 1

    Slice the tops off peppers and scoop out seeds. Arrange peppers cut-side up on a sheet pan.

  2. 2

    Heat a skillet over medium-high. Cook ground beef with diced onion, breaking up the meat, until no pink remains, about 5 minutes.

  3. 3

    Stir in half the queso fresco and 1 tbsp vinegar. Season with salt and pepper to taste.

  4. 4

    Divide the beef mixture between the pepper halves. Sprinkle remaining cheese on top. Bake at 400°F until peppers are tender and edges char, 10 minutes.

  5. 5

    Whisk sour cream with 1 tbsp water and a pinch of salt until pourable. Drizzle over hot peppers and garnish with cilantro.

Tools you’ll need

  • sharp knife
  • sheet pan
  • 12-inch skillet
  • wooden spoon
  • small whisk or fork
  • oven (preheated to 400°F)

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.