Custrd is out on the App Store — Download it free →
Back to recipes

BBQ Brisket Stuffed Baked Potato

Crispy-skinned baked potato loaded with shredded BBQ brisket, melted cheddar, and sour cream. Ready in under 20 minutes using store-bought smoked brisket.

Total time
18 min
Servings
2
Calories
720
Protein
42g
BBQ Brisket Stuffed Baked Potato
comfortsatisfyingamericanbeefcrispytendercreamyweeknight

Ingredients

  • 2 large (10 oz each) russet potatoes
  • 8 oz smoked brisket, shredded
  • ½ cup BBQ sauce
  • 1 cup sharp cheddar cheese, shredded
  • ¼ cup sour cream
  • 2 stalks scallions, sliced

Instructions

  1. 1

    Microwave potatoes on high for 8 minutes, turning halfway through. Skin should feel tender when pierced.

  2. 2

    Heat brisket with BBQ sauce in a small skillet over medium-high for 2 minutes, stirring occasionally, until warm.

  3. 3

    Split potatoes in half lengthwise. Scoop out centers slightly to create a shallow well, leaving a thin wall.

  4. 4

    Divide BBQ brisket between potato halves. Top each with 0.25 cup cheddar, spreading evenly.

  5. 5

    Broil 4 inches from heat for 3 minutes until cheese melts and begins to brown at edges.

  6. 6

    Top with a dollop of sour cream and scatter scallions over. Serve hot.

Tools you’ll need

  • microwave-safe plate
  • small skillet
  • broiler pan or rimmed sheet pan
  • sharp knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.