CookSnap is coming soon — Join the waitlist →
Back to recipes

BBQ Brisket Stuffed Potato with Crispy Cheese

Crispy-skin baked potatoes stuffed with tender shredded BBQ brisket, melted cheddar, and a dollop of cooling sour cream. Ready in under 30 minutes with rotisserie or leftover brisket.

Total time
25 min
Servings
2
Calories
620
Protein
38g
BBQ Brisket Stuffed Potato with Crispy Cheese
comfortsatisfyingamericanbeefcrispycreamytenderweeknight

Ingredients

  • 2 large russet potatoes
  • 1.5 cups shredded BBQ brisket (deli counter or leftover)
  • ½ cup BBQ sauce
  • 1 cup sharp cheddar, shredded
  • ½ cup sour cream
  • 2 tbsp fresh chives, chopped
  • 1 pinch salt and black pepper

Instructions

  1. 1

    Prick potatoes all over with a fork. Microwave on high for 12 minutes, turning halfway through, until tender inside.

  2. 2

    While potatoes cook, warm BBQ brisket and sauce together in a skillet over medium heat, stirring occasionally, 4 minutes.

  3. 3

    Halve each potato lengthwise. Scoop out centers, leaving a thin shell, and fluff the insides with a fork.

  4. 4

    Place potato halves skin-side down on a sheet pan. Divide BBQ brisket among the four halves, mounding it in the center.

  5. 5

    Top each with cheddar. Broil 4 inches from heat for 3 minutes until cheese melts and edges brown slightly.

  6. 6

    Top each potato with a dollop of sour cream and a pinch of fresh chives. Serve hot.

Tools you’ll need

  • microwave
  • skillet
  • sheet pan
  • broiler
  • spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.