Custrd is out on the App Store — Download it free →
Back to recipes

20-Min Rendang Padang with Rice & Egg

Tender beef simmered in a rich, spiced coconut sauce inspired by Padang's iconic rendang — served with steamed rice, hard-boiled egg, and crispy sides. Tastes like a restaurant dish but comes together in 20 minutes.

Total time
20 min
Servings
2
Calories
520
Protein
42g
20-Min Rendang Padang with Rice & Egg
comfortboldindonesianbeeftendercreamyweeknightdinner

Ingredients

  • ¾ lb beef sirloin or chuck, thinly sliced
  • 1 can (13.5 oz) coconut milk
  • 2 tbsp ginger, minced
  • 2 tbsp red chili paste or sambal oelek
  • ½ tsp turmeric powder
  • 2 cups steamed rice
  • 2 whole hard-boiled eggs

Instructions

  1. 1

    Heat 2 tbsp oil in a large skillet over medium-high heat until it shimmers, about 60 seconds.

  2. 2

    Add beef in a single layer and sear without stirring for 2 minutes until edges brown, then stir and cook 1 more minute.

  3. 3

    Push beef to the side, add ginger and chili paste to the empty space, stir 30 seconds until fragrant.

  4. 4

    Pour in coconut milk and turmeric, stir well, and simmer on medium for 8 minutes until sauce thickens and deepens in color.

  5. 5

    Taste and season with salt and pepper; the sauce should cling to the beef and smell aromatic.

  6. 6

    Serve rendang over steamed rice alongside hard-boiled eggs, cucumber slices, and crispy krupuk or chips.

Tools you’ll need

  • large skillet (12-inch)
  • wooden spoon or spatula
  • measuring spoons
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.