CookSnap is coming soon — Join the waitlist →
Back to recipes

25-Min Beef Rendang with Roti Canai

Tender beef in a rich, spiced coconut curry — the TikTok shortcut version using a rendang paste base. Served with store-bought roti canai for an authentic plate in under 30 minutes.

Total time
25 min
Servings
2
Calories
580
Protein
45g
25-Min Beef Rendang with Roti Canai
comfortsatisfyingindonesianbeeftendercreamyweeknightdinner

Ingredients

  • 1 lb beef sirloin or chuck, thinly sliced
  • 3 tbsp Indonesian rendang paste (jarred, e.g., Baraku or Conimex)
  • 1 can coconut milk (14 oz can)
  • ½ medium red onion, sliced thin
  • 2 cloves garlic, minced
  • ½ whole lime (juiced)
  • 2 pieces store-bought roti canai (or flatbread)
  • 1 small handful fresh cilantro (optional garnish)

Instructions

  1. 1

    Heat oil in a large skillet over medium-high until shimmering, about 90 seconds.

  2. 2

    Add beef in a single layer and sear 2 minutes per side without stirring. Transfer to a plate.

  3. 3

    Add red onion and garlic to the skillet, cook 90 seconds until fragrant and softened.

  4. 4

    Stir in rendang paste until it coats the onion, then pour in coconut milk and squeeze in lime juice.

  5. 5

    Return beef to the pan and simmer 8–10 minutes until sauce darkens and thickens, stirring occasionally.

  6. 6

    Warm roti canai in a dry skillet 30 seconds per side, then plate with beef rendang and garnish with cilantro.

Tools you’ll need

  • 12-inch skillet or large saucepan
  • wooden spoon or spatula
  • tongs
  • cutting board
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.

Craving more? Browse all Indonesian recipes →