CookSnap is coming soon — Join the waitlist →

Quick Beef Rendang

Aromatic coconut beef braise with ginger, garlic, and chili paste—deeply flavorful and ready in under an hour. Serve with rice to soak up the rich sauce.

Total time
50 min
Servings
4
Calories
410
Protein
42g
Quick Beef Rendang
comfortsatisfyingindonesianbeeftendercreamyweeknightdinner

Ingredients

  • 1.5 lb beef sirloin or chuck, cut into 1-inch cubes
  • 1 can (13.5 oz) coconut milk
  • 3 tbsp red curry paste
  • 4 cloves garlic, minced
  • 1 tbsp ginger, minced
  • 2 tbsp lime juice
  • 1 pinch salt and pepper to taste

Instructions

  1. 1

    Heat oil in a large heavy-bottomed pot or Dutch oven over medium-high heat until shimmering, about 90 seconds.

  2. 2

    Working in batches, sear beef cubes without stirring until browned on two sides, ~8 minutes total. Transfer to a plate.

  3. 3

    Add curry paste, garlic, and ginger to the pot. Stir constantly until fragrant and darkened slightly, ~2 minutes.

  4. 4

    Return beef and any juices to the pot. Pour in coconut milk and stir to combine.

  5. 5

    Bring to a simmer, then reduce heat to low. Cover and braise for 25 minutes, stirring occasionally.

  6. 6

    Uncover and simmer 5 more minutes to thicken sauce. Stir in lime juice, salt, and pepper.

  7. 7

    Serve hot over steamed rice or with flatbread.

Tools you’ll need

  • large heavy-bottomed pot or Dutch oven (at least 5-quart)
  • cutting board
  • chef's knife
  • wooden spoon
  • measuring spoons
  • microplane or box grater

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.