CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Nasi Lemak Rendang with Beef

Creamy coconut rice paired with rich, slow-cooked beef rendang infused with aromatics and spices. A complete Malaysian dinner that tastes restaurant-quality but comes together in one kitchen.

Total time
55 min
Servings
4
Calories
520
Protein
38g
Nasi Lemak Rendang with Beef
comfortindulgentmalaysianbeeftendercreamyweeknightdinner

Ingredients

  • 1.5 lb beef chuck, cut into 1.5-inch chunks
  • 1 can (14 oz) unsweetened coconut milk
  • 4 medium shallots, thinly sliced
  • 4 cloves garlic cloves, minced
  • 1 large fresh red chili, sliced (or 1 tsp chili flakes)
  • 1 tbsp ginger, grated
  • 2 stalks lemongrass, white part, minced
  • ¾ tsp turmeric powder
  • 2 cups jasmine rice
  • 1 cup coconut milk
  • 1 tsp salt salt and pepper to taste

Instructions

  1. 1

    Heat 2 tbsp oil in a heavy pot over medium. Add shallots, garlic, chili, and ginger; cook until fragrant, ~2 minutes.

  2. 2

    Add lemongrass and turmeric; stir constantly for 30 seconds until the mixture is deep golden and aromatic.

  3. 3

    Add beef chunks and stir until browned on all sides, breaking apart any lumps, ~5 minutes.

  4. 4

    Pour in coconut milk, scrape up any browned bits from the bottom, and bring to a simmer.

  5. 5

    Lower heat and simmer uncovered, stirring occasionally, until beef is tender and sauce clings to meat, ~30 minutes.

  6. 6

    While beef cooks, rinse rice under cold water until water runs clear; drain well.

  7. 7

    In a separate pot, combine rice, 1 cup coconut milk, and 1 cup water. Bring to a boil, then cover and reduce heat to low.

  8. 8

    Cook rice covered for 15 minutes, then check if liquid is absorbed. If not, cover and cook 2 more minutes. Season with salt.

  9. 9

    Divide rice among bowls and top with a generous spoonful of beef rendang and sauce. Serve hot.

Tools you’ll need

  • Heavy-bottomed pot or Dutch oven (at least 4-quart)
  • Medium pot with tight-fitting lid
  • Wooden spoon
  • Cutting board and chef's knife
  • Microplane or box grater for ginger
  • Measuring cups and spoons

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.