CookSnap is coming soon — Join the waitlist →
Back to recipes

Crispy Steak & Aligot Bowl

Stretchy, garlicky aligot (French melted-cheese mashed potatoes) topped with seared steak, peppery arugula, and bright sun-dried tomatoes. Pure comfort with a fancy edge.

Total time
25 min
Servings
2
Calories
720
Protein
38g
Crispy Steak & Aligot Bowl
comfortindulgentfrenchbeefcreamycrispytenderweeknight

Ingredients

  • 1.5 lb Yukon gold potatoes
  • 1.5 cups Gruyère cheese, shredded
  • 4 tbsp Butter
  • 3 cloves Garlic cloves, minced
  • 12 oz Steak (ribeye or NY strip)
  • ¼ cup Sun-dried tomatoes
  • 2 cups Fresh arugula

Instructions

  1. 1

    Cut potatoes into 1-inch cubes. Boil in salted water until fork-tender, ~12 minutes. Drain well.

  2. 2

    While potatoes cook, pat steak dry and season generously with salt and black pepper.

  3. 3

    Heat 1 tbsp butter in a heavy skillet over medium-high until it shimmers. Sear steak 90 seconds per side for medium-rare. Transfer to a plate.

  4. 4

    In the same skillet, melt remaining 3 tbsp butter over medium. Add minced garlic, cook until fragrant, ~30 seconds.

  5. 5

    Return drained potatoes to skillet. Mash roughly, then stir in cheese until stretchy and melted, ~2 minutes.

  6. 6

    Slice steak against the grain. Top aligot with steak, arugula, sun-dried tomatoes, and shaved Parmesan. Serve immediately.

Tools you’ll need

  • Large pot
  • Heavy 12-inch skillet
  • Colander
  • Wooden spoon
  • Potato masher
  • Instant-read thermometer (optional)

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.