CookSnap is in beta — Get it free on TestFlight →
Back to recipes

30-Min Beef & Carrot Braise with Mashed Potatoes

Tender beef chunks and carrots braised in red wine and beef broth, finished with creamy mashed potatoes and crispy microgreens. A weeknight take on the French classic that feels restaurant-quality in under 30 minutes.

Total time
30 min
Servings
4
Calories
620
Protein
48g
30-Min Beef & Carrot Braise with Mashed Potatoes
comfortelegantfrenchbeeftendercreamyweeknightdate-night

Ingredients

  • 1.5 lbs beef chuck, cut into 1.5-inch chunks
  • 1 lb carrots, cut into 1-inch rounds
  • ¾ cup red wine
  • 1 cup beef broth
  • 1.5 lbs potatoes, peeled and halved
  • 3 tbsp butter
  • 2 tbsp whole grain mustard
  • 2 sprigs fresh thyme or bay leaf

Instructions

  1. 1

    Boil potatoes in salted water until tender, 12–14 minutes. Drain and reserve.

  2. 2

    Pat beef dry. Heat 2 tbsp oil in a heavy skillet over medium-high until shimmering.

  3. 3

    Brown beef in batches, 2 minutes per side. Transfer to a plate.

  4. 4

    Add carrots and thyme to the skillet. Pour in wine and broth, scraping up browned bits.

  5. 5

    Return beef to the pan, bring to a simmer, and cook uncovered for 10 minutes until sauce thickens.

  6. 6

    Mash potatoes with butter, mustard, salt, and pepper until creamy. Divide among bowls.

  7. 7

    Ladle beef and carrots over mashed potatoes. Top with fresh microgreens and thinly sliced radishes.

Tools you’ll need

  • 12-inch heavy skillet or Dutch oven
  • large pot for potatoes
  • wooden spoon
  • tongs
  • slotted spoon
  • potato masher

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.