CookSnap is coming soon — Join the waitlist →
Back to recipes

30-Min Braised Beef Shank & Risotto

Tender beef shank seared and braised in red wine with beef broth, finished alongside creamy arborio risotto. A weeknight riff on French jarret de veau that tastes like Sunday dinner.

Total time
30 min
Servings
2
Calories
620
Protein
48g
30-Min Braised Beef Shank & Risotto
comfortelegantfrenchbeeftendercreamyweeknightdate-night

Ingredients

  • 1 lb beef shank or chuck, cut into 2-inch chunks
  • 1 cup arborio rice
  • 2.5 cups beef broth
  • ½ cup red wine (or additional broth)
  • 1 medium shallot, minced
  • ½ cup parmesan cheese, grated
  • 1 tsp fresh thyme or italian seasoning
  • 2 tbsp butter

Instructions

  1. 1

    Pat beef dry. Season with salt and pepper. Heat 1 tbsp oil in a large skillet over medium-high until shimmering.

  2. 2

    Sear beef 2 minutes per side without moving. Transfer to a plate.

  3. 3

    Add shallot to the same skillet, cook 60 seconds until fragrant. Pour in red wine and broth, scraping up any browned bits.

  4. 4

    Return beef to the skillet. Add thyme, bring to a simmer, and cook covered 12 minutes until beef is tender.

  5. 5

    While beef braises, heat remaining 1 tbsp oil in a separate small pot. Add rice, stir constantly for 2 minutes until translucent at edges.

  6. 6

    Ladle 0.5 cup hot braising liquid into the rice, stir until absorbed. Repeat, adding liquid a ladle at a time, stirring constantly, until rice is creamy and al dente (about 8 minutes).

  7. 7

    Stir butter and parmesan into the risotto. Taste and adjust salt and pepper.

  8. 8

    Spoon risotto onto plates. Top with beef shank and braising sauce.

Tools you’ll need

  • large heavy skillet with lid
  • small pot with lid
  • wooden spoon
  • tongs
  • ladle
  • measuring cups and spoons

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.