CookSnap is coming soon — Join the waitlist →
Back to recipes

Sartù: Crispy Rice Cake with Meat & Peas

A deconstructed sartù that skips the 90-minute oven time: crispy fried rice cake on the bottom, seasoned ground beef and peas layered on top, finished with mozzarella and a quick broil. Viral-worthy texture contrast — crispy outside, creamy inside.

Total time
25 min
Servings
4
Calories
545
Protein
28g
Sartù: Crispy Rice Cake with Meat & Peas
comfortindulgentitalianbeefcrispycreamytenderweeknight

Ingredients

  • 3 cups cooked rice, day-old or chilled
  • ½ lb ground beef
  • ¾ cup frozen peas
  • 3 tbsp tomato paste
  • 1.5 cup grated mozzarella, divided
  • ½ cup grated Parmesan
  • 1 large egg
  • ¼ cup beef broth

Instructions

  1. 1

    Mix cold rice with egg, 1 cup mozzarella, Parmesan, salt, and pepper in a bowl until sticky.

  2. 2

    Heat 2 tbsp oil in a 12-inch nonstick skillet over medium-high. Press rice mixture flat and fry 8 minutes until golden-brown and crispy on the bottom.

  3. 3

    Push rice to sides. Brown ground beef in center, breaking it up with a spoon, about 4 minutes until no pink shows.

  4. 4

    Stir in tomato paste, cook 30 seconds until fragrant, then add peas and broth. Simmer 2 minutes until peas warm.

  5. 5

    Scatter remaining 0.5 cup mozzarella over top. Slide under broiler 2 minutes until cheese melts and bubbles.

  6. 6

    Let cool 1 minute, slice into wedges, and serve hot.

Tools you’ll need

  • 12-inch nonstick skillet
  • mixing bowl
  • wooden spoon
  • broiler or toaster oven

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.