CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Sheet-Pan Shrimp Empanadas

Crispy, golden empanadas filled with garlicky shrimp, baked on a sheet pan in under 30 minutes. A weeknight shortcut using store-bought wrappers for restaurant-quality results.

Total time
25 min
Servings
2
Calories
285
Protein
16g
Sheet-Pan Shrimp Empanadas
quickcasualmexicanshrimpcrispytenderweeknightappetizer

Ingredients

  • 8 oz shrimp, peeled and deveined
  • 2 whole garlic cloves, minced
  • 1 whole lime
  • 6 whole empanada dough discs or wrappers
  • 2 tablespoons olive oil
  • 1 to taste salt and pepper

Instructions

  1. 1

    Set the oven to 400°F and wait until the indicator light or beep tells you it has finished heating, about 10 minutes.

  2. 2

    Mince the garlic until the pieces are smaller than a grain of rice—about the size of pencil-tip dots—and set aside in a small bowl.

  3. 3

    Cut the lime in half lengthwise from tip to tip, then squeeze both halves into a separate small bowl until you have about 2 tablespoons of juice.

  4. 4

    Place the shrimp in the bowl with the lime juice, add the minced garlic, sprinkle with a pinch of salt and pepper, and stir until all shrimp are coated.

  5. 5

    Let the shrimp sit in the lime mixture for 5 minutes so the flavors start to blend into the meat.

  6. 6

    Place one empanada wrapper on your work surface and spoon 1 tablespoon of the shrimp filling (including a bit of the lime juice) slightly to one side of the center, leaving a 1/2-inch border all around.

  7. 7

    Fold the wrapper in half over the filling to make a half-moon shape, then press the curved edge firmly with your fingers or a fork to seal it completely so no shrimp escapes during baking.

  8. 8

    Repeat the filling and folding for the remaining 5 wrappers until all 6 empanadas are sealed and placed in a line on a baking sheet.

  9. 9

    Brush or drizzle 2 tablespoons of olive oil over all 6 empanadas, coating both the top and sides, so they will brown evenly in the oven.

  10. 10

    Slide the baking sheet into the preheated 400°F oven and bake for 12 to 15 minutes until the wrapper surface turns golden brown and feels crispy when you tap it gently with a spatula.

  11. 11

    Remove the baking sheet from the oven using an oven mitt on both hands and set it on a heat-safe surface to cool for 2 minutes before serving.

Tools you’ll need

  • oven
  • baking sheet
  • small bowls (2)
  • cutting board
  • chef's knife
  • fork or your fingers (for sealing)
  • pastry brush or small spoon (for oil)
  • oven mitts

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.