CookSnap is coming soon — Join the waitlist →

Sheet-Pan Potato & Apple Cake

A crispy-edged German potato and apple skillet cake, ready in 20 minutes. Shredded potatoes and apples layer with onion and cheese for savory-sweet comfort food.

Total time
20 min
Servings
4
Calories
385
Protein
14g
Sheet-Pan Potato & Apple Cake
comfortrusticgermanvegetariancheesecrispytenderweeknight

Ingredients

  • 1.5 lbs potatoes, waxy (about 1.5 lbs)
  • 1 medium apple, tart variety
  • ½ medium yellow onion
  • 1 cup gruyère or emmental cheese, shredded
  • 1 tbsp whole-grain mustard
  • 1 tsp thyme, fresh (optional)

Instructions

  1. 1

    Heat 3 tbsp olive oil in a 12-inch skillet over medium-high heat until shimmering.

  2. 2

    Shred the potatoes and apple on a box grater. Thinly slice the onion. Toss with salt and pepper.

  3. 3

    Spread the potato-apple mixture in the skillet, pressing down. Cook until the bottom is golden and crispy, about 8 minutes. You'll smell it browning.

  4. 4

    Scatter cheese and thyme over the top. Swirl mustard with 2 tbsp water, then drizzle over.

  5. 5

    Flip in sections using a spatula (or slide onto a plate and flip back into the pan) and cook 4 more minutes until the second side is golden.

  6. 6

    Slide onto a cutting board. Let rest 2 minutes, then cut into wedges and serve hot.

Tools you’ll need

  • 12-inch cast iron or stainless skillet
  • box grater
  • spatula
  • cutting board
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.