CookSnap is coming soon — Join the waitlist →
Back to recipes

Sheet-Pan Focaccia with Herbs & Olives

A TikTok-easy vegan focaccia inspired by Provençal flavors, made with store-bought dough and finished with rosemary, garlic, and briny olives. Sheet-pan bake, 15 minutes total.

Total time
18 min
Servings
4
Calories
285
Protein
6g
Sheet-Pan Focaccia with Herbs & Olives
rusticsimplefrenchmediterraneanvegandairy-freecrispyfluffy

Ingredients

  • 1 lb vegan pizza or focaccia dough (store-bought, room temp)
  • 3 tbsp olive oil
  • 3 cloves garlic, minced
  • 1 tbsp fresh rosemary (or thyme), chopped
  • ½ cup Kalamata or green olives, pitted and halved
  • 1 tsp fleur de sel or coarse sea salt

Instructions

  1. 1

    Preheat oven to 425°F. Line a sheet pan with parchment paper.

  2. 2

    Stretch dough to fill the pan, pressing gently with oiled fingertips until even thickness.

  3. 3

    Drizzle 2 tbsp olive oil over dough. Scatter minced garlic and rosemary across the surface.

  4. 4

    Press olives into the dough, spacing them evenly. Drizzle final tbsp of oil over top.

  5. 5

    Bake 12–15 minutes until golden and edges pull away from pan sides slightly.

  6. 6

    Scatter fleur de sel over hot focaccia. Cool 2 minutes, slice, and serve warm.

Tools you’ll need

  • sheet pan
  • parchment paper
  • oven (425°F)
  • small bowl for oil

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.

Craving more? Browse all French recipes →