CookSnap is coming soon — Join the waitlist →
Back to recipes

20-Min Herbed Flatbread with Olive Oil

A quick, crispy herbed flatbread with a tender crumb and olive-oil finish—no yeast rising required. Tear and dip in more oil, or serve alongside soup.

Total time
18 min
Servings
2
Calories
310
Protein
6g
20-Min Herbed Flatbread with Olive Oil
simplerusticfrenchvegancrispytenderflakyweeknight

Ingredients

  • 1.5 cups all-purpose flour
  • ¾ cup warm water
  • 4 tbsp extra-virgin olive oil, divided
  • 1.5 tsp dried herbes de Provence (or italian seasoning)
  • ¾ tsp coarse sea salt
  • ¼ tsp instant yeast

Instructions

  1. 1

    Mix flour, yeast, and salt in a bowl. Pour in warm water and 2 tbsp olive oil, stir until shaggy.

  2. 2

    Knead by hand or with a wooden spoon for 3 minutes until smooth and slightly elastic.

  3. 3

    Stretch dough into a rough oval on an oiled sheet pan, about 1/2-inch thick.

  4. 4

    Drizzle with 1 tbsp olive oil, sprinkle herbes de Provence evenly. Let rest 5 minutes.

  5. 5

    Use your fingers to poke dimples across the surface, creating a lattice-like texture.

  6. 6

    Bake at 425°F for 10–12 minutes until edges are golden and surface is crispy. Drizzle with remaining 1 tbsp oil. Serve warm.

Tools you’ll need

  • mixing bowl
  • wooden spoon
  • sheet pan
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.