CookSnap is coming soon — Join the waitlist →
Back to recipes

Crispy Herb Fougasse

A 25-minute baked flatbread inspired by Provençal fougasse—stretchy, dimpled, and brushed with herbed olive oil. No yeast rising required; uses store-bought dough for weeknight ease.

Total time
25 min
Servings
4
Calories
285
Protein
7g
Crispy Herb Fougasse
rusticcasualfrenchvegancrispyairyweeknightbread

Ingredients

  • 1 lb pizza dough (thawed if frozen, room temperature)
  • 4 tbsp olive oil, divided
  • 1 tbsp fresh herbs (rosemary, thyme, or Italian seasoning)
  • 2 cloves garlic, minced
  • 1 tsp fleur de sel or coarse sea salt
  • ¼ tsp red pepper flakes (optional)
  • ½ lemon lemon (zested)

Instructions

  1. 1

    Preheat oven to 450°F. Line a large sheet pan with parchment paper.

  2. 2

    Stretch dough on the pan into a thin 12×8-inch rectangle. Use your fingers to dimple the surface all over.

  3. 3

    Whisk together 3 tbsp olive oil, herbs, minced garlic, red pepper flakes, and lemon zest in a small bowl.

  4. 4

    Brush herb oil evenly over the dough. Sprinkle with coarse salt. Slash 3–4 diagonal cuts into the bread without cutting all the way through.

  5. 5

    Bake until edges are deep golden and center springs back when poked, 12–15 minutes. Surface should look crispy and puffed.

  6. 6

    Drizzle with remaining 1 tbsp olive oil. Cool 2 minutes, then tear into pieces and serve warm.

Tools you’ll need

  • sheet pan (18×13-inch)
  • parchment paper
  • small bowl
  • whisk
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.