CookSnap is in beta — Get it free on TestFlight →
Back to recipes

20-Min Focaccia Barese with Tomato & Olive

Crispy-bottomed, pillowy focaccia baked straight from store-bought dough, topped with cherry tomatoes, Castelvetrano olives, and a drizzle of olive oil. Ready in 20 minutes.

Total time
20 min
Servings
2
Calories
420
Protein
8g
20-Min Focaccia Barese with Tomato & Olive
casualsimpleitalianvegetariandairy-freecrispyfluffytender

Ingredients

  • 1 lb store-bought pizza dough (or focaccia dough)
  • 1 cup cherry tomatoes, halved
  • ¾ cup Castelvetrano olives, pitted and halved
  • 3 tbsp extra-virgin olive oil
  • 1 tsp sea salt
  • 1 tbsp fresh rosemary or oregano (optional)

Instructions

  1. 1

    Heat oven to 450°F. Oil a sheet pan generously with 1 tbsp olive oil.

  2. 2

    Stretch dough to fit the pan, pressing with oily fingertips until 1/2-inch thick.

  3. 3

    Dimple the surface all over with your fingertips, creating small pockets.

  4. 4

    Scatter tomatoes and olives over top, drizzle with 2 tbsp olive oil, sprinkle with sea salt.

  5. 5

    Bake for 12-15 minutes until bottom is golden and edges pull away from pan sides.

  6. 6

    Top with fresh herbs if using. Cool 2 minutes, slice, and serve warm.

Tools you’ll need

  • sheet pan (13x18 inches)
  • oven
  • small bowl

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.