CookSnap is coming soon — Join the waitlist →

Sesame Shrimp Bowl

Tender shrimp with a ginger-soy glaze over warm rice, topped with crispy cucumbers, avocado, and sesame seeds. Ready in under 30 minutes.

Total time
25 min
Servings
2
Calories
420
Protein
28g
Sesame Shrimp Bowl
freshquickasiandairy-freeshrimptendercrispyweeknight

Ingredients

  • 2 cups cooked rice (white or brown)
  • ¾ lb large shrimp, peeled and deveined
  • 3 tbsp soy sauce
  • 1 tbsp rice vinegar
  • 1 tbsp fresh ginger, minced
  • 2 cloves garlic, minced
  • 1 medium cucumber, thinly sliced
  • 1 whole avocado, sliced
  • 2 tbsp sesame seeds (white or black)

Instructions

  1. 1

    Stir soy sauce, rice vinegar, ginger, and garlic in a small bowl.

  2. 2

    Pat shrimp dry with paper towels. Season lightly with salt and pepper.

  3. 3

    Heat oil in a large skillet over medium-high until it shimmers, ~90 seconds.

  4. 4

    Add shrimp and cook without stirring 90 seconds, then flip and cook 60 more seconds until pink throughout.

  5. 5

    Pour the soy-ginger sauce over shrimp. Toss to coat and cook 30 seconds until glossy.

  6. 6

    Divide rice between two bowls. Top with shrimp and sauce.

  7. 7

    Arrange cucumber slices and avocado on top. Sprinkle with sesame seeds.

  8. 8

    Serve immediately while shrimp is hot.

Tools you’ll need

  • small bowl
  • paper towels
  • 12-inch skillet
  • 2 serving bowls
  • tongs or fork

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.