CookSnap is coming soon — Join the waitlist →

Garlic Ginger Shrimp Bowl

Tender shrimp glazed in a bright garlic-ginger sauce over fluffy rice, topped with crisp vegetables and fresh herbs. Ready in 25 minutes.

Total time
25 min
Servings
2
Calories
420
Protein
28g
Garlic Ginger Shrimp Bowl
freshquickasianshrimptendercrispyweeknightbowl

Ingredients

  • 2 cups cooked jasmine rice
  • ¾ lb shrimp, peeled and deveined
  • 3 cloves garlic, minced
  • 1 tbsp fresh ginger, minced
  • 3 tbsp soy sauce
  • 1 whole lime (juiced)
  • ½ whole cucumber, sliced thin
  • ¼ cup fresh cilantro or scallion, chopped

Instructions

  1. 1

    Heat 2 tbsp oil in a large skillet over medium-high until it shimmers, ~90 seconds.

  2. 2

    Add shrimp and cook without stirring for 90 seconds until bottoms turn pink.

  3. 3

    Flip shrimp and cook 60 seconds more until opaque throughout.

  4. 4

    Push shrimp to the side. Add garlic and ginger to the empty space, stir 30 seconds until fragrant.

  5. 5

    Pour soy sauce and lime juice over the shrimp. Toss to coat, cook 30 seconds.

  6. 6

    Divide rice between two bowls. Top with shrimp and sauce.

  7. 7

    Arrange cucumber slices on top. Garnish with cilantro and serve immediately.

Tools you’ll need

  • large skillet (12-inch)
  • wooden spoon or spatula
  • chef's knife
  • cutting board
  • two bowls

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.