CookSnap is coming soon — Join the waitlist →
Back to recipes

Sesame Ginger Shrimp Soba Bowl

Chewy soba noodles in a silky ginger-sesame broth, topped with seared shrimp and tender bok choy. Ready in 15 minutes—weeknight perfection.

Total time
15 min
Servings
2
Calories
385
Protein
28g
Sesame Ginger Shrimp Soba Bowl
freshquickjapaneseshrimpchewytendersilkyweeknight

Ingredients

  • 8 oz soba noodles
  • ½ lb whole shrimp, peeled and deveined
  • 4 cups bok choy, chopped into 2-inch pieces
  • 3 cups low-sodium vegetable or dashi broth
  • 2 tbsp sesame oil
  • 1 tbsp fresh ginger, minced
  • 2 tbsp soy sauce

Instructions

  1. 1

    Bring a large pot of salted water to a boil. Cook soba noodles until al dente, ~4 minutes. Drain and rinse under cold water. Set aside.

  2. 2

    Heat 1 tbsp sesame oil in a large skillet over medium-high heat until shimmering, ~60 seconds.

  3. 3

    Add shrimp in a single layer. Sear 90 seconds per side without moving until opaque and pink. Transfer to a plate.

  4. 4

    In the same skillet, add ginger and stir for 30 seconds until fragrant. Pour in broth and soy sauce. Bring to a simmer.

  5. 5

    Add bok choy and cook for 2 minutes until stems soften but leaves stay bright green.

  6. 6

    Divide cooked noodles between two bowls. Ladle broth and bok choy over top. Top with shrimp and drizzle with remaining 1 tbsp sesame oil. Serve hot.

Tools you’ll need

  • large pot
  • large skillet (12-inch preferred)
  • measuring spoons
  • measuring cups
  • tongs or slotted spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.