CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Kiriboshi Daikon Stir-Fry

Tender-chewy dried daikon rehydrated and stir-fried with soy, mirin, and sesame in one pan. Nutty, umami-rich, and ready in under 15 minutes.

Total time
12 min
Servings
2
Calories
125
Protein
2g
Kiriboshi Daikon Stir-Fry
quickwholesomejapanesevegetarianvegandairy-freechewytender

Ingredients

  • 1 cup kiriboshi daikon (dried daikon strips)
  • 1 medium carrot
  • 2 tbsp soy sauce
  • 1.5 tbsp mirin (or honey)
  • 1 tbsp sesame oil
  • 1 tbsp sesame seeds (white or black)

Instructions

  1. 1

    Soak kiriboshi daikon in warm water for 4 minutes until softened but still chewy.

  2. 2

    Drain daikon well. Julienne the carrot into thin matchsticks.

  3. 3

    Heat sesame oil in a large skillet over medium-high heat until shimmering, about 1 minute.

  4. 4

    Add daikon and carrot, stirring constantly until edges brown and char slightly, 3–4 minutes.

  5. 5

    Pour soy sauce and mirin over the vegetables and toss for 30 seconds until glossy.

  6. 6

    Transfer to a bowl and scatter sesame seeds on top. Serve warm.

Tools you’ll need

  • large skillet (10–12 inch)
  • small bowl for soaking
  • knife and cutting board

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.