Kiriboshi Daikon Stir-Fry
Tender-chewy dried daikon rehydrated and stir-fried with soy, mirin, and sesame in one pan. Nutty, umami-rich, and ready in under 15 minutes.
- Total time
- 12 min
- Servings
- 2
- Calories
- 125
- Protein
- 2g
quickwholesomejapanesevegetarianvegandairy-freechewytender
Ingredients
- 1 cup kiriboshi daikon (dried daikon strips)
- 1 medium carrot
- 2 tbsp soy sauce
- 1.5 tbsp mirin (or honey)
- 1 tbsp sesame oil
- 1 tbsp sesame seeds (white or black)
Instructions
- 1
Soak kiriboshi daikon in warm water for 4 minutes until softened but still chewy.
- 2
Drain daikon well. Julienne the carrot into thin matchsticks.
- 3
Heat sesame oil in a large skillet over medium-high heat until shimmering, about 1 minute.
- 4
Add daikon and carrot, stirring constantly until edges brown and char slightly, 3–4 minutes.
- 5
Pour soy sauce and mirin over the vegetables and toss for 30 seconds until glossy.
- 6
Transfer to a bowl and scatter sesame seeds on top. Serve warm.
Tools you’ll need
- large skillet (10–12 inch)
- small bowl for soaking
- knife and cutting board
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
