Custrd is out on the App Store — Download it free →
Back to recipes

20-Min Seafood Mohinga

Burmese fish curry soup that comes together in one pot with shrimp, rice noodles, and a fragrant turmeric-garlic broth. Topped with crispy fried shallots and lime — pure TikTok comfort.

Total time
20 min
Servings
2
Calories
385
Protein
28g
20-Min Seafood Mohinga
comfortboldburmeseshrimptendersilkyweeknightcozy

Ingredients

  • ¾ lb shrimp, peeled and deveined
  • 2 tbsp fish sauce
  • 1 tsp turmeric powder
  • ½ tsp dried red chili flakes
  • 4 cloves garlic, minced
  • 1 whole fresh lime
  • 4 oz rice vermicelli noodles
  • ¼ cup crispy fried shallots

Instructions

  1. 1

    Bring 4 cups water to a boil in a large pot over medium-high heat.

  2. 2

    Add turmeric, chili flakes, minced garlic, and fish sauce to the boiling water.

  3. 3

    Add rice noodles and cook for 3 minutes until just softened, stirring once.

  4. 4

    Add shrimp and simmer for 2 minutes, stirring gently, until pink and just cooked through.

  5. 5

    Squeeze lime juice into the pot and stir. Taste and add salt if needed.

  6. 6

    Ladle into bowls and top generously with crispy fried shallots. Serve immediately.

Tools you’ll need

  • large pot (4-5 quart capacity)
  • wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.