Custrd is out on the App Store — Download it free →
Back to recipes

Roasted Vegetable and Chicken Bowl

A quick, colorful bowl of roasted chicken and vegetables with a simple lemon-yogurt sauce. Perfect for a busy weeknight.

Total time
30 min
Servings
4
Calories
350
Protein
30g
Roasted Vegetable and Chicken Bowl
comfortinghealthyamericangluten-freechickentendercrispyweeknight

Ingredients

  • 1 lb chicken breast
  • 2 cups broccoli florets
  • 2 medium carrots
  • 1 medium sweet potato
  • 1 red bell pepper
  • ½ cup plain yogurt

Instructions

  1. 1

    Preheat oven to 425°F. Cut the 1 lb chicken breast into 1-inch pieces. Toss with 2 tbsp olive oil, salt, and pepper on a baking sheet.

  2. 2

    Chop the 2 cups broccoli, 2 carrots, 1 sweet potato, and 1 red bell pepper into bite-size pieces. Add to the baking sheet, drizzle with 1 tbsp olive oil, and toss to coat.

  3. 3

    Roast for 20-25 minutes, until chicken is cooked through and vegetables are tender and lightly charred, stirring once halfway.

  4. 4

    Meanwhile, mix the 0.5 cup yogurt with 1 tbsp lemon juice, salt, and pepper to make a sauce.

  5. 5

    Serve the roasted chicken and vegetables in bowls, drizzled with the yogurt sauce. Add a squeeze of lemon if desired.

Tools you’ll need

  • baking sheet
  • knife
  • cutting board
  • mixing bowl

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.