Custrd is out on the App Store — Download it free →
Back to recipes

Roast Chicken with Potatoes and Herbs

A quick and hearty sheet-pan dinner with juicy chicken pieces, crispy potatoes, and sweet roasted tomatoes, all infused with garlic and rosemary.

Total time
40 min
Servings
4
Calories
650
Protein
45g
Roast Chicken with Potatoes and Herbs
comfortingweeknightamericangluten-freechickencrispytenderweeknight dinner

Ingredients

  • 2 lb chicken pieces
  • 1.5 lb baby potatoes
  • 1 pint cherry tomatoes
  • 4 cloves garlic cloves
  • 2 tbsp fresh rosemary
  • 3 tbsp olive oil

Instructions

  1. 1

    Preheat oven to 425°F. On a large rimmed baking sheet, toss the 1.5 lb baby potatoes and 1 pint cherry tomatoes with 2 tbsp olive oil, salt, and pepper. Spread in a single layer.

  2. 2

    Pat the 2 lb chicken pieces dry and place them among the potatoes. Rub the chicken with the remaining 1 tbsp olive oil and season generously with salt and pepper.

  3. 3

    Scatter the 4 garlic cloves (smashed) and 2 tbsp chopped rosemary over everything. Roast for 25-30 minutes, until the chicken is golden and cooked through (juices run clear) and the potatoes are tender when pierced with a fork.

  4. 4

    If you like extra crispiness, broil for the last 2-3 minutes until the chicken skin is deeply browned. Serve hot, spooning any pan juices over the top.

Tools you’ll need

  • rimmed baking sheet
  • chef's knife
  • cutting board
  • mixing spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.