Quesadilla
A crispy tortilla filled with grilled chicken, bell peppers, onions, and melted cheese, served with french fries, cucumber slices, shredded carrots, and fresh herbs.
- Total time
- 20 min
- Servings
- 1
- Calories
- 750
- Protein
- 35g
comfort foodMexicanchickencrispymeltyweeknight dinnermain dishlunch
Ingredients
- 1 large flour tortilla
- 100 g grilled chicken breast
- 50 g bell peppers
- 30 g onion
- 50 g cheddar cheese
- 150 g french fries
- 50 g cucumber
- 30 g shredded carrots
- 5 g fresh herbs (cilantro or parsley)
- 1 tbsp vegetable oil
Instructions
- 1
Heat oil in a skillet over medium heat and sauté sliced peppers and onions until soft.
- 2
Add grilled chicken strips and warm through for 2 minutes.
- 3
Place tortilla in the skillet, sprinkle half with cheese, then add chicken mixture.
- 4
Top with remaining cheese and fold tortilla over; press gently.
- 5
Cook until golden and crispy, about 2 minutes per side.
- 6
Serve with french fries, cucumber slices, shredded carrots, and chopped herbs.
Tools you’ll need
- skillet
- spatula
- knife
- cutting board
Cook smarter
Get matched recipes for what’s in your fridge
Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
